Fitness Seller

Eindeloos afbeulen??


Hoe lang train je per keer?

  • half uur/ drie kwartier

    Stemmen: 33 20,9%
  • Een uur of een beetje meer

    Stemmen: 94 59,5%
  • anderhalf/twee uur

    Stemmen: 24 15,2%
  • beestachtig: ruim twee uur

    Stemmen: 7 4,4%

  • Totaal stemmers
    158

Users who are viewing this topic

ErEf

Advanced Bodybuilder
+15 jaar member
Lid geworden
21 okt 2002
Berichten
763
Waardering
1
glutaforce is de naam van glutamine van J-tech
 

ErEf

Advanced Bodybuilder
+15 jaar member
Lid geworden
21 okt 2002
Berichten
763
Waardering
1
Originally posted by Big Cat Over die link van je, er staat geen enkele referentie bij en die vent lult wat uit zijn nek.
hahaha... die reactie hadden we kunnen verwachten... het artikel was geschreven door WK
 

ErEf

Advanced Bodybuilder
+15 jaar member
Lid geworden
21 okt 2002
Berichten
763
Waardering
1
Originally posted by Esperantisto
Um, betekent dat niet dat ik na KT spieren kwijtraak omdat ik op een ketogeen dieet zit waarin slechts een minieme hoeveelheid KH wordt aangevoerd.. meestal drink ik na KT kwark vermengd met slagroom en kokos en nu eindelijk ook een flinke hoeveelheid weipoeder.
Ik heb niet altijd tijd, bijv. wo en za tussen KT en spinning nog te eten, ben ik dan niet bezig mijn spieren af te breken.. beide sessies duren plm 45 minuten.
off topic-- ik zal dit ook in voeding plaatsen dus aldaar reacties erop.
In melk producten zit lactose. lactose is een suiker dat opgebouwd is uit galactose en glucose. Dit veroorzaakt insuline afgifte. Niet te gebruiken dus tijdens keto periodes.
Melk staat niet hoog op de GI (rond de 30) dat inhoud dat de suiker uit melk relatief langzaam vrijkomt in het bloed, maar daar staat tegenover dat het hoog op de Insuline Index staat. Dus dat wat vrijkomt makkelijk de afgifte van insuline bevorderd en dat over een langere periode.
 
Laatst bewerkt:

burn

Advanced Bodybuilder
+15 jaar member
Lid geworden
22 okt 2002
Berichten
1.407
Waardering
17
Originally posted by Big Cat


Inderdaad. Maar je kunt dit tegengaan op enkele manieren.

Eerst en vooral het beperken van de verbrande spieren. Door caseine als voornaamste bron van eiwitten te nemen, vertraag je oxidatie van aminozuren over lange perioden, tot 6 uren. Grootste spierverlies gebeurt tussen maaltijden door, en het lichaam prefereert glutamine als energie bron. Ik vind glutamine tijdens het bulken onzin, maar essentieel voor dieet. Door glutamine te nemen tussen maaltijden, telkens 5 gram, verbrand je de toegevoegde glutamine en niet die in de spieren (60% van skeletspieren bestaat uit glutamine).

Vervolgens het beperken van adenosine aanmaak in het lichaam en het bevorderen van leptine. Zinc chelaat, Vitamine E en een paar andere supplementen helpen dit bevorderen. Maar wat je eigenlijk moet doen is carb loaden. Ketogeen dieet voor 10 dagen, daarna 2 dagen vetten verlagen en koolhydraten toevoegen. Cell slaat koolhydraten op, leptine verhoogt, adenosine verlaagt en je doet opnieuw 10 dagen ketogeen. Regelmatig carbloaden dus.

Goede post. Zelf vind ik het nog effectiever om 2 x per week te carbloaden. Bijvoorbeeld 3 en 4 dag van de week en dan 1 maaltijd koolhydraten laden. Leptine schijnt na 1 week dieeten namelijk al gedaald te zijn met 50%. Natuurlijk ben je dan niet ketogeen meer maar dat is mijn ogen ook niet belangrijk. Ketonen zorgen er immers niet voor dat je vet verbrandt, belangrijker is de beheersing van insuline.
 

Esperantisto

Freaky Bodybuilder
+15 jaar member
Lid geworden
11 okt 2002
Berichten
6.844
Waardering
25
[Link niet meer beschikbaar]

Lees dat maar eens: gaat over carboloading om de leptine weer op normaal niveau te krijgen, speciaal het schema voor optimale carboloading frequentie is interessant.

lichaamsvet% >20% : na 7-10 dagen, duur 24-48 uur

lichaamsvet% 15-20% : na 5 dagen, duur 24-48 uur.
lichaamsvet% 10-15%: na 4 dagen, duur 48 uur
lichaamsvet% <10%: na 3 dagen, duur 48-72 uur

Ik denk dat ik met mijn eigen speklaag van 35% het wel makkelijk op 14 dagen kan houden, dan heb ik maar 1x per 14 dagen die KH-verlangens..
 

burn

Advanced Bodybuilder
+15 jaar member
Lid geworden
22 okt 2002
Berichten
1.407
Waardering
17
Ja sorry is natuurlijk ook afhankelijk van bf% en ook verschil tussen man en vrouw.
Toch zou ik het minstens op 1 x per week houden.
Die carbs up zorgen ook voor beter herstel + meer energie de volgende training, dat is onafhankelijk van leptine. Ook denk ik dat je 1x per week zelfs nog meer vet verliest dan 1x per 14 dagen, ondanks de ietswat hogere totaal kcal inname.

Als je kh laden een hele dag doet maakt natuurlijk wel een verschil met 1 maaltijd kh laden en dan 2 x per week. Ik heb beide gedaan en vond 1 maaltijd 2 x in de week effectiever, maar zal persoonlijk zijn.
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Originally posted by burn


Goede post. Zelf vind ik het nog effectiever om 2 x per week te carbloaden. Bijvoorbeeld 3 en 4 dag van de week en dan 1 maaltijd koolhydraten laden. Leptine schijnt na 1 week dieeten namelijk al gedaald te zijn met 50%. Natuurlijk ben je dan niet ketogeen meer maar dat is mijn ogen ook niet belangrijk. Ketonen zorgen er immers niet voor dat je vet verbrandt, belangrijker is de beheersing van insuline.

Hoeveel je leptine daalt en over welke periode is afhankelijk van het lichaamsvet % waar je mee begint. Hoe lager je vetpercentage, hoe lager je leptine.
 

burn

Advanced Bodybuilder
+15 jaar member
Lid geworden
22 okt 2002
Berichten
1.407
Waardering
17
Originally posted by Big Cat


Hoeveel je leptine daalt en over welke periode is afhankelijk van het lichaamsvet % waar je mee begint. Hoe lager je vetpercentage, hoe lager je leptine.

Ja klopt had ik in de post daaronder al vermeld ook.
Ik was van mijn eigen v.b uitgegaan(man + relatief laag bf%). Toch is de leptine daling in 1 week sowieso hoog, dus lijkt me minstens 1x per week effectiever.
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Ik neem meestal andere maatregelen om spiermassa te beschermen ook, dus ik vind het niet zo noodzakelijk om frequenter te loaden.
 

Esperantisto

Freaky Bodybuilder
+15 jaar member
Lid geworden
11 okt 2002
Berichten
6.844
Waardering
25
Ff off/on-topic.. ik heb een bestelling voor een nieuwe zak weipoeder (4,5 kg voor 48 USD) geplaatst evenals glutamine. Beiden kunnen vrij lang bewaard worden.
Heb ik 2x5 gram glutamine /dag nodig? Alleen tijdens KT-dagen of op alle trainingsdagen incl. cardio?
Graag snel antwoord want de ander is 'zogezegd' aan de lijn, dwz vertrekt spoedig voor een meeting (is powerlifter).
De glutamine is 28 USD per 600 gram. Hij ried me 5-10 gram per KT-dag aan.. ik dacht eerder aan 5 gram per trainingsdag of heeft een te lage dosis geen zin?
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
Originally posted by Big Cat
Nee hoor, skeletspierweefsel bestaat voor 60% uit echte glutamine.
??? Hoe kan nou een functioneel eiwit uit zoveel van hetzelfde bestaan? Heb je misschien een link, BC. Het is niet dat ik je niet geloof, ik heb ook geen bewijs ertegen, dus waarom zou ik niet, maar ik vind het gewoon raar.
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Originally posted by Esperantisto
Ff off/on-topic.. ik heb een bestelling voor een nieuwe zak weipoeder (4,5 kg voor 48 USD) geplaatst evenals glutamine. Beiden kunnen vrij lang bewaard worden.
Heb ik 2x5 gram glutamine /dag nodig? Alleen tijdens KT-dagen of op alle trainingsdagen incl. cardio?
Graag snel antwoord want de ander is 'zogezegd' aan de lijn, dwz vertrekt spoedig voor een meeting (is powerlifter).
De glutamine is 28 USD per 600 gram. Hij ried me 5-10 gram per KT-dag aan.. ik dacht eerder aan 5 gram per trainingsdag of heeft een te lage dosis geen zin?

Als je dieet 4 tot 5 x 5 gram per dag, als je bulkt, niet.
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Originally posted by wateengedoe2

??? Hoe kan nou een functioneel eiwit uit zoveel van hetzelfde bestaan? Heb je misschien een link, BC. Het is niet dat ik je niet geloof, ik heb ook geen bewijs ertegen, dus waarom zou ik niet, maar ik vind het gewoon raar.

Zou eens moeten zoeken voor je, maar die quote, als het helpt, kwam recht uit mijn boek voor het eerste jaar dat ik systeemfysiologie had. Het heet Human Physiology van Sherwood, en ik heb de derde druk (boek van rond de 125 euro).
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
Originally posted by Big Cat
Ik neem meestal andere maatregelen om spiermassa te beschermen ook, dus ik vind het niet zo noodzakelijk om frequenter te loaden.
Die maatregelen zijn vast niet aan te raden voor espi ;) :)
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
Originally posted by Big Cat


Zou eens moeten zoeken voor je, maar die quote, als het helpt, kwam recht uit mijn boek voor het eerste jaar dat ik systeemfysiologie had. Het heet Human Physiology van Sherwood, en ik heb de derde druk (boek van rond de 125 euro).
Ik heb ook een boek Human physiology, geen idee of dat van Sherwood is .. Het kostte iig geen 125 euro (eerder 125 gulden) en .... ligt bij mijn ouders :D Damn! ;)
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Ik had het nochtans over glutamine, BCAA en caseine, regelmatig eten in kleine hoeveelheden.
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
BC, ben eens aan het googelen geslagen ..

van deze site ->

The active phase of training is highly catabolic. During this time, glycogen stores are quickly depleted and the liver must synthesized glucose. It performs this function by converting the amino acid L-Alanine to glucose. This amino acid along with glutamine account for more than 50% of the total amino acid released from muscle tissue. In skeletal muscle, 60% of the free amino acid pool is glutamine. Glutamine release is from free glutamine stores within the muscle and from deamination (removal of ammonia molecule) of branched-chain amino acids.

Het lijkt erop dat jij de vrije a.z.-voorraad in skeletspieren bedoelde en niet de a.z. in de spiereiwitten zelf? Ik ga nog eens verderzoeken of ik iets kan vinden over dat laatste ...
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
Ah, gelukkig ik ben niet gek! ;) Na ff zoeken hierde aminozuursequentie van 1 van de menselijke vormen van het myosine-heavy chain eiwit .. Bij lange na geen 60% glutamine.

Dit is 'em :D Elk Q'tje is een glutamine ..

MSSDSELAVFGEAAPFLRKSERERIEAQNRPFDAKTSVFVAEPKESFVKGTIQSREGGKVTVKTEGGATL
TVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVV
TAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEI
TSGKIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQL
KAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKV
SIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTV
EQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQ
FFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHL
GKSANFQKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTA
EGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLR
CNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVF
FKAGLLGLLEEMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFF
KIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEER
CDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENK
VKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKL
RMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQAR
IEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQ
HEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLED
QLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIK
AKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLA
QRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETH
AELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVE
QEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAE
IRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMV
ERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDI
LQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQK
LEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEE
AEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKSREVHTKVISEE

OK, I know, ik ben toch gek ;) :D

Maar het was dus de vrije-a.z. voorraad waar die 60% glutamine op sloeg en niet de spiereiwitten zelf.
 

Big Cat

CEO @Muscleandsportsscience.be
Elite Member
+15 jaar member
Lid geworden
8 okt 2002
Berichten
3.180
Waardering
336
Lengte
1m84
Massa
97kg
Vetpercentage
6%
Ach zo, wel dat wil zeggen dat glutamine duidelijk het eerste geoxideerd wordt dan, als je 60% van de voorraad nodig hebt om het te vervangen.
 

wateengedoe2

Advanced Bodybuilder
+15 jaar member
Lid geworden
9 okt 2002
Berichten
980
Waardering
1
Ik denk dat vrije aminozuren, voor zover mogeljk, snel naar glutamine worden omgezeet in de spier, dat verklaard het overschot aan vrij glutamine daar :)
 

Bovenaan